![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein Plastocyanin [49507] (17 species) |
![]() | Species Poplar (Populus nigra), variant italica [TaxId:3691] [49508] (16 PDB entries) |
![]() | Domain d1plca_: 1plc A: [22846] complexed with cu |
PDB Entry: 1plc (more details), 1.33 Å
SCOPe Domain Sequences for d1plca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn
Timeline for d1plca_: