SCOP 1.61: Domain d1mdab_: 1mda B:

Lineage for d1mdab_ (1mda B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)

6. Protein Amicyanin [49505] (2 species)

7. Species Paracoccus denitrificans [TaxId:266] [49506] (7 PDB entries)

8. Domain d1mdab_: 1mda B: [22845]
   Other proteins in same PDB: d1mdah_, d1mdaj_, d1mdal_, d1mdam_

Details for d1mdab_

PDB Entry: 1mda, 2.5 Å

PDB Description: crystal structure of an electron-transfer complex between methylamine dehydrogenase and amicyanin

SCOP Domain Sequences for d1mdab_:

Sequence; same for both SEQRES and ATOM records:

>d1mdab_ b.6.1.1 (B:) Amicyanin {Paracoccus denitrificans}
atipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvagvl
geaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

Timeline for d1mdab_:

• d1mdab_ first appeared (with stable ids) in SCOP 1.55
  
• d1mdab_ appears in SCOP 1.59
  
• d1mdab_ appears in SCOP 1.63
  
• d1mdab_ appears in the current release, SCOPe 2.08