Lineage for d1mdab_ (1mda B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins) Protein Amicyanin [49505] (1 species) Species Paracoccus denitrificans [TaxId:266] [49506] (7 PDB entries) 
Domain d1mdab_: 1mda B: [22845]
Other proteins in same PDB: d1mdah_, d1mdaj_, d1mdal_, d1mdam_
Details for d1mdab_
PDB Entry: 1mda (more details), 2.5 Å
PDB Description: crystal structure of an electron-transfer complex between methylamine dehydrogenase and amicyanin
PDB Compounds: (B:) SCOP Domain Sequences for d1mdab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mdab_ b.6.1.1 (B:) Amicyanin {Paracoccus denitrificans}
atipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvagvl
geaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
SCOP Domain Coordinates for d1mdab_:
Click to download the PDB-style file with coordinates for d1mdab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mdab_:
- d1mdab_ appears in SCOP 1.57
- d1mdab_ appears in the current release, SCOPe 2.07
View in 3D
