![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
![]() | Protein automated matches [190230] (23 species) not a true protein |
![]() | Species Mycobacterium abscessus [TaxId:561007] [228435] (1 PDB entry) |
![]() | Domain d4guzd1: 4guz D:1-278 [228437] Other proteins in same PDB: d4guza2, d4guzb2, d4guzc2, d4guzd2 automated match to d1gx3a_ |
PDB Entry: 4guz (more details), 1.8 Å
SCOPe Domain Sequences for d4guzd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4guzd1 d.3.1.0 (D:1-278) automated matches {Mycobacterium abscessus [TaxId: 561007]} mwngdelqldeylafigfdgdrsptletlrrlqrghvlnikwenldavlhkhvaldipav qakllrsprggycyehvalfgavlqrlgfdfygiqgrvqmgattirpathgmlvvrlaae qwlcdvgfgtsplapirlvdeavvadeswtyrlrrgevtpgadgwtlseaagdgsepgwl srhtfvlepqypidyraasyfvassphspfstrafvqqispdhayildhrelheiqpgvg rktrqltpaevlatlreifgielgaddstlllerlaeq
Timeline for d4guzd1: