![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) ![]() |
![]() | Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins) |
![]() | Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (26 PDB entries) Uniprot P20434; part of multichain biological unit |
![]() | Domain d4c2mt1: 4c2m T:4-143 [228430] Other proteins in same PDB: d4c2m1_, d4c2me2, d4c2mf_, d4c2mh_, d4c2mj_, d4c2mk_, d4c2ml_, d4c2mt2, d4c2mu_, d4c2mw_, d4c2my_, d4c2mz_ automated match to d1twfe1 complexed with so4, zn |
PDB Entry: 4c2m (more details), 2.8 Å
SCOPe Domain Sequences for d4c2mt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c2mt1 c.52.3.1 (T:4-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} enernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfqan pteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsamkl vpsippatietfneaalvvn
Timeline for d4c2mt1: