Lineage for d2mtaa_ (2mta A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 10907Protein Amicyanin [49505] (1 species)
  7. 10908Species Paracoccus denitrificans [TaxId:266] [49506] (7 PDB entries)
  8. 10914Domain d2mtaa_: 2mta A: [22843]
    Other proteins in same PDB: d2mtac_, d2mtah_, d2mtal_

Details for d2mtaa_

PDB Entry: 2mta (more details), 2.4 Å

PDB Description: crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
PDB Compounds: (A:)

SCOP Domain Sequences for d2mtaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mtaa_ b.6.1.1 (A:) Amicyanin {Paracoccus denitrificans}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

SCOP Domain Coordinates for d2mtaa_:

Click to download the PDB-style file with coordinates for d2mtaa_.
(The format of our PDB-style files is described here.)

Timeline for d2mtaa_: