![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
![]() | Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
![]() | Family a.143.1.2: RPB6 [55294] (1 protein) |
![]() | Protein RPB6 [55295] (3 species) essential subunit of RNA polymerases I, II and III |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (30 PDB entries) Uniprot P20435; part of multichain biological unit |
![]() | Domain d4c2mu_: 4c2m U: [228429] Other proteins in same PDB: d4c2m1_, d4c2me1, d4c2me2, d4c2mh_, d4c2mj_, d4c2ml_, d4c2mt1, d4c2mt2, d4c2mw_, d4c2my_ automated match to d2nvqf_ complexed with so4, zn |
PDB Entry: 4c2m (more details), 2.8 Å
SCOPe Domain Sequences for d4c2mu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c2mu_ a.143.1.2 (U:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pedfqqheqirrktlkekaipkdqrattpymtkyerarilgtralqismnapvfvdlege tdplriamkelaekkiplvirrylpdgsfedwsveelivd
Timeline for d4c2mu_: