Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) automatically mapped to Pfam PF01194 |
Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins) Zn-binding site is near the N-terminus |
Protein RNA polymerase subunit RPB10 [46926] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (28 PDB entries) Uniprot P22139; part of multichain biological unit |
Domain d4c2mj_: 4c2m J: [228428] Other proteins in same PDB: d4c2m1_, d4c2me1, d4c2me2, d4c2mf_, d4c2mh_, d4c2mk_, d4c2ml_, d4c2mt1, d4c2mt2, d4c2mu_, d4c2mw_, d4c2mz_ automated match to d1twfj_ complexed with so4, zn |
PDB Entry: 4c2m (more details), 2.8 Å
SCOPe Domain Sequences for d4c2mj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c2mj_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf lrynplekr
Timeline for d4c2mj_: