Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.2: Tetramerization domain of potassium channels [54701] (7 proteins) |
Protein automated matches [228419] (1 species) not a true protein |
Species Homo sapiens [TaxId:9606] [228420] (1 PDB entry) |
Domain d4bgca_: 4bgc A: [228421] automated match to d1t1da_ |
PDB Entry: 4bgc (more details), 1.2 Å
SCOPe Domain Sequences for d4bgca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bgca_ d.42.1.2 (A:) automated matches {Homo sapiens [TaxId: 9606]} mervvinisglrfetqlktlcqfpetllgdpkrrmryfdplrneyffdrnrpsfdailyy yqsggrirrpvnvpidifseeirfyqlgeeamekfredegfl
Timeline for d4bgca_: