Lineage for d4mtva2 (4mtv A:241-308)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2509610Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2510080Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 2510081Family d.26.3.1: Chitinase insertion domain [54557] (10 protein domains)
  6. 2510229Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
    secreted during involution
  7. 2510230Species Buffalo (Bubalus bubalis) [TaxId:89462] [110873] (8 PDB entries)
    Uniprot Q7YS85
  8. 2510233Domain d4mtva2: 4mtv A:241-308 [228417]
    Other proteins in same PDB: d4mtva1
    automated match to d2o9oa2
    complexed with nag

Details for d4mtva2

PDB Entry: 4mtv (more details), 2.8 Å

PDB Description: Crystal structure of the complex of Buffalo Signalling Glycoprotein with pentasaccharide at 2.8A resolution
PDB Compounds: (A:) Chitinase-3-like protein 1

SCOPe Domain Sequences for d4mtva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mtva2 d.26.3.1 (A:241-308) Signal processing protein (SPC-40, MGP-40) {Buffalo (Bubalus bubalis) [TaxId: 89462]}
grsytlassktdvgapisgpgipgrftkwkgilayyeicdflhgatthrfrdqqvpyatk
gnqwvayd

SCOPe Domain Coordinates for d4mtva2:

Click to download the PDB-style file with coordinates for d4mtva2.
(The format of our PDB-style files is described here.)

Timeline for d4mtva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mtva1