Lineage for d1aaja_ (1aaj A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527467Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1527468Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1527469Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1527470Protein Amicyanin [49505] (2 species)
  7. 1527471Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries)
    Uniprot P22364
  8. 1527496Domain d1aaja_: 1aaj A: [22841]

Details for d1aaja_

PDB Entry: 1aaj (more details), 1.8 Å

PDB Description: crystal structure analysis of amicyanin and apoamicyanin from paracoccus denitrificans at 2.0 angstroms and 1.8 angstroms resolution
PDB Compounds: (A:) amicyanin

SCOPe Domain Sequences for d1aaja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aaja_ b.6.1.1 (A:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

SCOPe Domain Coordinates for d1aaja_:

Click to download the PDB-style file with coordinates for d1aaja_.
(The format of our PDB-style files is described here.)

Timeline for d1aaja_: