| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) ![]() |
| Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
| Protein automated matches [190066] (5 species) not a true protein |
| Species Pea (Pisum sativum) [TaxId:3888] [193409] (2 PDB entries) |
| Domain d4mkvu_: 4mkv U: [228402] Other proteins in same PDB: d4mkva1, d4mkva2, d4mkvb1, d4mkvb2, d4mkvc1, d4mkvc2, d4mkvd1, d4mkvd2 automated match to d4hhht_ complexed with a8s, po4, rub |
PDB Entry: 4mkv (more details), 2.15 Å
SCOPe Domain Sequences for d4mkvu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mkvu_ d.73.1.1 (U:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
mqvwppigkkkfetlsylppltrdqllkeveyllrkgwvpclefelkkgfvyrehnkspg
yydgrywtmwklpmfgttdasqvlkeldevkkayprafvriigfdnvrqvqcisfiahtp
agy
Timeline for d4mkvu_: