SCOP 1.65: Domain d2raca_: 2rac A:

Lineage for d2raca_ (2rac A:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
   mono-domain proteins

6. Protein Amicyanin [49505] (2 species)

7. Species Paracoccus denitrificans [TaxId:266] [49506] (9 PDB entries)

8. Domain d2raca_: 2rac A: [22840]
   complexed with cu

Details for d2raca_

PDB Entry: 2rac, 1.3 Å

PDB Description: amicyanin reduced, ph 7.7, 1.3 angstroms

SCOP Domain Sequences for d2raca_:

Sequence; same for both SEQRES and ATOM records:

>d2raca_ b.6.1.1 (A:) Amicyanin {Paracoccus denitrificans}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

Timeline for d2raca_:

• d2raca_ first appeared (with stable ids) in SCOP 1.55
  
• d2raca_ appears in SCOP 1.63
  
• d2raca_ appears in SCOP 1.67
  
• d2raca_ appears in the current release, SCOPe 2.08