Lineage for d2raca_ (2rac A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 162480Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
  4. 162481Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
  5. 162482Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 162483Protein Amicyanin [49505] (2 species)
  7. 162484Species Paracoccus denitrificans [TaxId:266] [49506] (7 PDB entries)
  8. 162487Domain d2raca_: 2rac A: [22840]

Details for d2raca_

PDB Entry: 2rac (more details), 1.3 Å

PDB Description: amicyanin reduced, ph 7.7, 1.3 angstroms

SCOP Domain Sequences for d2raca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2raca_ b.6.1.1 (A:) Amicyanin {Paracoccus denitrificans}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

SCOP Domain Coordinates for d2raca_:

Click to download the PDB-style file with coordinates for d2raca_.
(The format of our PDB-style files is described here.)

Timeline for d2raca_: