Lineage for d2raca_ (2rac A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106628Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 106629Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 106630Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 106631Protein Amicyanin [49505] (2 species)
  7. 106632Species Paracoccus denitrificans [TaxId:266] [49506] (7 PDB entries)
  8. 106635Domain d2raca_: 2rac A: [22840]

Details for d2raca_

PDB Entry: 2rac (more details), 1.3 Å

PDB Description: amicyanin reduced, ph 7.7, 1.3 angstroms

SCOP Domain Sequences for d2raca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2raca_ b.6.1.1 (A:) Amicyanin {Paracoccus denitrificans}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

SCOP Domain Coordinates for d2raca_:

Click to download the PDB-style file with coordinates for d2raca_.
(The format of our PDB-style files is described here.)

Timeline for d2raca_: