Lineage for d4mh5a1 (4mh5 A:4-258)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915760Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries)
  8. 2915799Domain d4mh5a1: 4mh5 A:4-258 [228397]
    Other proteins in same PDB: d4mh5a2
    automated match to d3s9ea_
    complexed with cl, ggl, gol, k

Details for d4mh5a1

PDB Entry: 4mh5 (more details), 1.65 Å

PDB Description: crystal structure of the kainate receptor gluk3 ligand binding domain in complex with (s)-glutamate
PDB Compounds: (A:) Glutamate receptor ionotropic, kainate 3

SCOPe Domain Sequences for d4mh5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mh5a1 c.94.1.0 (A:4-258) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tnrslivttlleepfvmfrksdrtlygndrfegycidllkelahilgfsyeirlvedgky
gaqddkgqwngmvkelidhkadlavapltithvrekaidfskpfmtlgvsilyrkgtpid
saddlakqtkieygavkdgatmtffkkskistfekmwafmsskpsalvknneegiqrtlt
adyallmesttieyitqrncnltqigglidskgygigtpmgspyrdkitiailqlqeedk
lhimkekwwrgsgcp

SCOPe Domain Coordinates for d4mh5a1:

Click to download the PDB-style file with coordinates for d4mh5a1.
(The format of our PDB-style files is described here.)

Timeline for d4mh5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mh5a2