Lineage for d1bxaa_ (1bxa A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. Protein Amicyanin [49505] (2 species)
  7. Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries)
    Uniprot P22364
  8. Domain d1bxaa_: 1bxa A: [22839]
    complexed with cu1

Details for d1bxaa_

PDB Entry: 1bxa (more details), 1.3 Å

PDB Description: amicyanin reduced, ph 4.4, 1.3 angstroms
PDB Compounds: (A:) protein (amicyanin)

SCOPe Domain Sequences for d1bxaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxaa_ b.6.1.1 (A:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

SCOPe Domain Coordinates for d1bxaa_ are not available.

Timeline for d1bxaa_: