Lineage for d1aac__ (1aac -)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 224388Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 224389Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 224390Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
    mono-domain proteins
  6. 224391Protein Amicyanin [49505] (2 species)
  7. 224392Species Paracoccus denitrificans [TaxId:266] [49506] (9 PDB entries)
  8. 224393Domain d1aac__: 1aac - [22838]
    complexed with cu

Details for d1aac__

PDB Entry: 1aac (more details), 1.31 Å

PDB Description: amicyanin oxidized, 1.31 angstroms
PDB Compounds: ( :)

SCOP Domain Sequences for d1aac__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aac__ b.6.1.1 (-) Amicyanin {Paracoccus denitrificans}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

SCOP Domain Coordinates for d1aac__:

Click to download the PDB-style file with coordinates for d1aac__.
(The format of our PDB-style files is described here.)

Timeline for d1aac__: