![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Ubiquitin [54238] (9 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [224919] (41 PDB entries) |
![]() | Domain d4ljob_: 4ljo B: [228379] automated match to d1ogwa_ complexed with imd, zn |
PDB Entry: 4ljo (more details), 1.56 Å
SCOPe Domain Sequences for d4ljob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ljob_ d.15.1.1 (B:) Ubiquitin {Cow (Bos taurus) [TaxId: 9913]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d4ljob_: