![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
![]() | Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (25 PDB entries) |
![]() | Domain d4l8da1: 4l8d A:1-181 [228376] Other proteins in same PDB: d4l8da2, d4l8db_, d4l8dc2, d4l8dd_ automated match to d1n3na2 complexed with so4 |
PDB Entry: 4l8d (more details), 1.9 Å
SCOPe Domain Sequences for d4l8da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l8da1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]} gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll r
Timeline for d4l8da1:
![]() Domains from other chains: (mouse over for more information) d4l8db_, d4l8dc1, d4l8dc2, d4l8dd_ |