SCOPe 2.04: Domain d4l8sb2: 4l8s B:116-243

Lineage for d4l8sb2 (4l8s B:116-243)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4l8sb2: 4l8s B:116-243 [228373]
   Other proteins in same PDB: d4l8sa2
   automated match to d3q5ya2
   complexed with so4

Details for d4l8sb2

PDB Entry: 4l8s, 2.9 Å

PDB Description: crystal structure of a human valpha7.2/vbeta13.3 mait tcr in complex with bovine mr1

PDB Compounds: (B:) Muccosal Associated Invariant T Cell Receptor beta chain

SCOPe Domain Sequences for d4l8sb2:

Sequence; same for both SEQRES and ATOM records:

>d4l8sb2 b.1.1.0 (B:116-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d4l8sb2:

• d4l8sb2 first appeared in SCOPe 2.03
  
• d4l8sb2 appears in SCOPe 2.05
  
• d4l8sb2 appears in the current release, SCOPe 2.08