Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (25 PDB entries) |
Domain d4l8ca1: 4l8c A:1-181 [228368] Other proteins in same PDB: d4l8ca2, d4l8cb_, d4l8cc2, d4l8cd_, d4l8ce2, d4l8cf_, d4l8cg2, d4l8ch_ automated match to d1n3na2 complexed with so4 |
PDB Entry: 4l8c (more details), 2.8 Å
SCOPe Domain Sequences for d4l8ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l8ca1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]} gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll r
Timeline for d4l8ca1: