SCOPe 2.04: Domain d4l8ce2: 4l8c E:182-275

Lineage for d4l8ce2 (4l8c E:182-275)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (103 PDB entries)
   Uniprot P01901 22-299

8. Domain d4l8ce2: 4l8c E:182-275 [228367]
   Other proteins in same PDB: d4l8ca1, d4l8cb_, d4l8cc1, d4l8cd_, d4l8ce1, d4l8cf_, d4l8cg1, d4l8ch_
   automated match to d1n3na1
   complexed with so4

Details for d4l8ce2

PDB Entry: 4l8c, 2.8 Å

PDB Description: crystal structure of the h2db in complex with the np-n3d peptide

PDB Compounds: (E:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d4l8ce2:

Sequence; same for both SEQRES and ATOM records:

>d4l8ce2 b.1.1.2 (E:182-275) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwe

Timeline for d4l8ce2:

• d4l8ce2 first appeared in SCOPe 2.03
  
• d4l8ce2 appears in SCOPe 2.05
  
• d4l8ce2 appears in the current release, SCOPe 2.08