![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class I MHC, alpha-3 domain [88604] (4 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries) Uniprot P01901 22-299 |
![]() | Domain d4l8cg2: 4l8c G:182-275 [228365] Other proteins in same PDB: d4l8ca1, d4l8cb_, d4l8cc1, d4l8cd_, d4l8ce1, d4l8cf_, d4l8cg1, d4l8ch_ automated match to d1n3na1 complexed with so4 |
PDB Entry: 4l8c (more details), 2.8 Å
SCOPe Domain Sequences for d4l8cg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l8cg2 b.1.1.2 (G:182-275) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf qkwasvvvplgkeqnytcrvyheglpepltlrwe
Timeline for d4l8cg2: