Lineage for d4l8cg1 (4l8c G:1-181)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406058Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1406349Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (25 PDB entries)
  8. 1406396Domain d4l8cg1: 4l8c G:1-181 [228364]
    Other proteins in same PDB: d4l8ca2, d4l8cb_, d4l8cc2, d4l8cd_, d4l8ce2, d4l8cf_, d4l8cg2, d4l8ch_
    automated match to d1n3na2
    complexed with so4

Details for d4l8cg1

PDB Entry: 4l8c (more details), 2.8 Å

PDB Description: crystal structure of the h2db in complex with the np-n3d peptide
PDB Compounds: (G:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d4l8cg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l8cg1 d.19.1.1 (G:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

SCOPe Domain Coordinates for d4l8cg1:

Click to download the PDB-style file with coordinates for d4l8cg1.
(The format of our PDB-style files is described here.)

Timeline for d4l8cg1: