SCOPe 2.08: Domain d4l8ba2: 4l8b A:182-276

Lineage for d4l8ba2 (4l8b A:182-276)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries)
   Uniprot P01901 22-299

8. Domain d4l8ba2: 4l8b A:182-276 [228363]
   Other proteins in same PDB: d4l8ba1, d4l8bb_
   automated match to d1n3na1
   complexed with na, peg, so4

Details for d4l8ba2

PDB Entry: 4l8b, 2.2 Å

PDB Description: crystal structure of the h2db in complex with the np-n5h peptide

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d4l8ba2:

Sequence; same for both SEQRES and ATOM records:

>d4l8ba2 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

Timeline for d4l8ba2:

• d4l8ba2 first appeared in SCOPe 2.03
  
• d4l8ba2 appears in SCOPe 2.07