SCOPe 2.07: Domain d4l8ba1: 4l8b A:1-181

Lineage for d4l8ba1 (4l8b A:1-181)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (28 PDB entries)

8. Domain d4l8ba1: 4l8b A:1-181 [228362]
   Other proteins in same PDB: d4l8ba2, d4l8bb_
   automated match to d1n3na2
   complexed with na, peg, so4

Details for d4l8ba1

PDB Entry: 4l8b, 2.2 Å

PDB Description: crystal structure of the h2db in complex with the np-n5h peptide

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d4l8ba1:

Sequence; same for both SEQRES and ATOM records:

>d4l8ba1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

Timeline for d4l8ba1:

• d4l8ba1 first appeared in SCOPe 2.03
  
• d4l8ba1 appears in SCOPe 2.06
  
• d4l8ba1 appears in the current release, SCOPe 2.08