Lineage for d4l8cc1 (4l8c C:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2938003Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (29 PDB entries)
  8. 2938057Domain d4l8cc1: 4l8c C:1-181 [228360]
    Other proteins in same PDB: d4l8ca2, d4l8cb_, d4l8cc2, d4l8cd_, d4l8ce2, d4l8cf_, d4l8cg2, d4l8ch_
    automated match to d1n3na2
    complexed with so4

Details for d4l8cc1

PDB Entry: 4l8c (more details), 2.8 Å

PDB Description: crystal structure of the h2db in complex with the np-n3d peptide
PDB Compounds: (C:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d4l8cc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l8cc1 d.19.1.1 (C:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

SCOPe Domain Coordinates for d4l8cc1:

Click to download the PDB-style file with coordinates for d4l8cc1.
(The format of our PDB-style files is described here.)

Timeline for d4l8cc1: