Lineage for d4kjga1 (4kjg A:1-482)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138453Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2138454Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2138455Family c.76.1.1: Alkaline phosphatase [53650] (2 protein domains)
    common fold is decorated with several large insertions
    automatically mapped to Pfam PF00245
  6. 2138558Protein automated matches [190176] (2 species)
    not a true protein
  7. 2138567Species Norway rat (Rattus norvegicus) [TaxId:10116] [228351] (2 PDB entries)
  8. 2138570Domain d4kjga1: 4kjg A:1-482 [228352]
    Other proteins in same PDB: d4kjga2, d4kjgb2
    automated match to d1zeba_
    complexed with 4np, mg, nag, zn

Details for d4kjga1

PDB Entry: 4kjg (more details), 2.38 Å

PDB Description: Structure of Rat Intestinal Alkaline Phosphatase expressed in insect cell
PDB Compounds: (A:) Intestinal-type alkaline phosphatase 1

SCOPe Domain Sequences for d4kjga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kjga1 c.76.1.1 (A:1-482) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vipveeenpvfwnqkakealdvakklqpiqtsaknlilflgdgmgvptvtatrilkgqlg
ghlgpetplamdhfpftalsktynvdrqvpdsagtataylcgvkanyktigvsaaarfnq
cnstfgnevfsvmhrakkagksvgvvtttrvqhaspagtyahtvnrdwysdadmpssalq
egckdiatqlisnmdidvilgggrkfmfpkgtpdpeypgdsdqsgvrldsrnlveewlak
yqgtryvwnreqlmqasqdpavtrlmglfeptemkydvnrnasadpslaemtevavrlls
rnpqgfylfveggridqghhagtaylalteavmfdsaiekasqltnekdtltlitadhsh
vfafggytlrgtsifglaplnaqdgksytsilygngpgyvlnsgnrpnvtdaesgdvnyk
qqaavplssethggedvaifargpqahlvhgvqeqnyiahvmafagclepytdcglappa
de

SCOPe Domain Coordinates for d4kjga1:

Click to download the PDB-style file with coordinates for d4kjga1.
(The format of our PDB-style files is described here.)

Timeline for d4kjga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kjga2