Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein automated matches [191280] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189896] (33 PDB entries) |
Domain d4h26e1: 4h26 E:6-92 [228344] Other proteins in same PDB: d4h26a1, d4h26a2, d4h26b2, d4h26b3, d4h26b4, d4h26d1, d4h26d2, d4h26e2, d4h26e3, d4h26e4 automated match to d2sebb2 |
PDB Entry: 4h26 (more details), 2.5 Å
SCOPe Domain Sequences for d4h26e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h26e1 d.19.1.1 (E:6-92) automated matches {Human (Homo sapiens) [TaxId: 9606]} rflellksechffngtervrfleryfhnqeefvrfdsdvgeyravtelgrpvaeswnsqk dlleqkrgqvdtycrhnygvvesftvq
Timeline for d4h26e1: