Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
Protein automated matches [190294] (4 species) not a true protein |
Species Escherichia coli [TaxId:83333] [193218] (4 PDB entries) |
Domain d4jbaa_: 4jba A: [228343] automated match to d3vb2b_ |
PDB Entry: 4jba (more details), 2.5 Å
SCOPe Domain Sequences for d4jbaa_:
Sequence, based on SEQRES records: (download)
>d4jbaa_ a.4.5.28 (A:) automated matches {Escherichia coli [TaxId: 83333]} lfneiiplgrlihmvnqkkdrllneylsplditaaqfkvlssirsaasitpvelkkvlsv dlgaltrmldrlvckgwverlpnpndkrgvlvklttggaaiseqshqlvgqdlhqeltkn ltadevatleyllkkvlp
>d4jbaa_ a.4.5.28 (A:) automated matches {Escherichia coli [TaxId: 83333]} lfneiiplgrlihmvnqkkdrllneylsplditaaqfkvlssirsaasitpvelkkvlsv dlgaltrmldrlvckgwverlpnpnvlvklttggaaiseqshqlvgqdlhqeltknltad evatleyllkkvlp
Timeline for d4jbaa_: