Lineage for d4j0la_ (4j0l A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2495000Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2495001Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2495002Family d.2.1.1: Family 19 glycosidase [53956] (2 protein domains)
    automatically mapped to Pfam PF00182
  6. 2495010Protein automated matches [190455] (7 species)
    not a true protein
  7. 2495031Species Secale cereale [TaxId:4550] [194813] (3 PDB entries)
  8. 2495036Domain d4j0la_: 4j0l A: [228342]
    automated match to d2baaa_
    complexed with edo, so4; mutant

Details for d4j0la_

PDB Entry: 4j0l (more details), 1.9 Å

PDB Description: Crystal Structure of a Family GH19 Chitinase (W72A/E67Q mutant) from rye seeds in complex with two (GlcNAc)4 molecules
PDB Compounds: (A:) Basic endochitinase C

SCOPe Domain Sequences for d4j0la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j0la_ d.2.1.1 (A:) automated matches {Secale cereale [TaxId: 4550]}
svssiishaqfdrmllhrndgacqakgfytydafvaaanafpgfgatgstdarkrdvaaf
laqtshqttggaatapdgafawgycfkqergaaadyctpsaqwpcapgkryygrgpiqls
hnynygpagraigvdllrnpdlvatdptvsfktalwfwmtaqapkpsshavitgkwspsg
adraagrapgfgvitniingglecghgqdsrvadrigfykrycdilgvgygdnldcynqr
pfa

SCOPe Domain Coordinates for d4j0la_:

Click to download the PDB-style file with coordinates for d4j0la_.
(The format of our PDB-style files is described here.)

Timeline for d4j0la_: