Lineage for d4h26a2 (4h26 A:82-181)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747348Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)
  7. 2747358Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
    Uniprot P01903 28-207
    probably orthologous to the mouse I-E group
  8. 2747386Domain d4h26a2: 4h26 A:82-181 [228341]
    Other proteins in same PDB: d4h26a1, d4h26b1, d4h26b2, d4h26b3, d4h26b4, d4h26d1, d4h26e1, d4h26e2, d4h26e3, d4h26e4
    automated match to d1fv1a1

Details for d4h26a2

PDB Entry: 4h26 (more details), 2.5 Å

PDB Description: tcr interaction with peptide mimics of nickel offers structure insight to nickel contact allergy
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4h26a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h26a2 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOPe Domain Coordinates for d4h26a2:

Click to download the PDB-style file with coordinates for d4h26a2.
(The format of our PDB-style files is described here.)

Timeline for d4h26a2: