| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) |
| Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries) Uniprot P01903 28-207 probably orthologous to the mouse I-E group |
| Domain d4h26a2: 4h26 A:82-181 [228341] Other proteins in same PDB: d4h26a1, d4h26b1, d4h26b2, d4h26b3, d4h26b4, d4h26d1, d4h26e1, d4h26e2, d4h26e3, d4h26e4 automated match to d1fv1a1 |
PDB Entry: 4h26 (more details), 2.5 Å
SCOPe Domain Sequences for d4h26a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h26a2 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
Timeline for d4h26a2: