SCOPe 2.08: Domain d4h26d2: 4h26 D:82-181

Lineage for d4h26d2 (4h26 D:82-181)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
   Uniprot P01903 28-207
   probably orthologous to the mouse I-E group

8. Domain d4h26d2: 4h26 D:82-181 [228340]
   Other proteins in same PDB: d4h26a1, d4h26b1, d4h26b2, d4h26b3, d4h26b4, d4h26d1, d4h26e1, d4h26e2, d4h26e3, d4h26e4
   automated match to d1fv1a1

Details for d4h26d2

PDB Entry: 4h26, 2.5 Å

PDB Description: tcr interaction with peptide mimics of nickel offers structure insight to nickel contact allergy

PDB Compounds: (D:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4h26d2:

Sequence; same for both SEQRES and ATOM records:

>d4h26d2 b.1.1.2 (D:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

Timeline for d4h26d2:

• d4h26d2 first appeared in SCOPe 2.03
  
• d4h26d2 appears in SCOPe 2.07