SCOPe 2.08: Domain d4h26a1: 4h26 A:3-81

Lineage for d4h26a1 (4h26 A:3-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries)
   Uniprot P01903 28-207

8. Domain d4h26a1: 4h26 A:3-81 [228339]
   Other proteins in same PDB: d4h26a2, d4h26b1, d4h26b2, d4h26b3, d4h26b4, d4h26d2, d4h26e1, d4h26e2, d4h26e3, d4h26e4
   automated match to d1aqda2
   fragment; missing more than one-third of the common structure and/or sequence

Details for d4h26a1

PDB Entry: 4h26, 2.5 Å

PDB Description: tcr interaction with peptide mimics of nickel offers structure insight to nickel contact allergy

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4h26a1:

Sequence; same for both SEQRES and ATOM records:

>d4h26a1 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

Timeline for d4h26a1:

• d4h26a1 first appeared in SCOPe 2.03
  
• d4h26a1 appears in SCOPe 2.07