Lineage for d4h26a1 (4h26 A:3-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938226Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2938236Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries)
    Uniprot P01903 28-207
  8. 2938250Domain d4h26a1: 4h26 A:3-81 [228339]
    Other proteins in same PDB: d4h26a2, d4h26b1, d4h26b2, d4h26b3, d4h26b4, d4h26d2, d4h26e1, d4h26e2, d4h26e3, d4h26e4
    automated match to d1aqda2
    fragment; missing more than one-third of the common structure and/or sequence

Details for d4h26a1

PDB Entry: 4h26 (more details), 2.5 Å

PDB Description: tcr interaction with peptide mimics of nickel offers structure insight to nickel contact allergy
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4h26a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h26a1 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

SCOPe Domain Coordinates for d4h26a1:

Click to download the PDB-style file with coordinates for d4h26a1.
(The format of our PDB-style files is described here.)

Timeline for d4h26a1: