Lineage for d4h26d1 (4h26 D:3-81)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406537Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1406547Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries)
    Uniprot P01903 28-207
  8. 1406565Domain d4h26d1: 4h26 D:3-81 [228338]
    Other proteins in same PDB: d4h26a2, d4h26b1, d4h26b2, d4h26d2, d4h26e1, d4h26e2
    automated match to d1aqda2

Details for d4h26d1

PDB Entry: 4h26 (more details), 2.5 Å

PDB Description: tcr interaction with peptide mimics of nickel offers structure insight to nickel contact allergy
PDB Compounds: (D:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4h26d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h26d1 d.19.1.1 (D:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

SCOPe Domain Coordinates for d4h26d1:

Click to download the PDB-style file with coordinates for d4h26d1.
(The format of our PDB-style files is described here.)

Timeline for d4h26d1: