Lineage for d4h25d2 (4h25 D:82-182)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747348Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)
  7. 2747358Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
    Uniprot P01903 28-207
    probably orthologous to the mouse I-E group
  8. 2747369Domain d4h25d2: 4h25 D:82-182 [228337]
    Other proteins in same PDB: d4h25a1, d4h25b1, d4h25b2, d4h25b3, d4h25b4, d4h25d1, d4h25e1, d4h25e2, d4h25e3, d4h25e4
    automated match to d1kg0a1
    complexed with ipa

Details for d4h25d2

PDB Entry: 4h25 (more details), 2.2 Å

PDB Description: tcr interaction with peptide mimics of nickel offers structure insights to nickel contact allergy
PDB Compounds: (D:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4h25d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h25d2 b.1.1.2 (D:82-182) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda

SCOPe Domain Coordinates for d4h25d2:

Click to download the PDB-style file with coordinates for d4h25d2.
(The format of our PDB-style files is described here.)

Timeline for d4h25d2: