Lineage for d4ilfa2 (4ilf A:61-213)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1601461Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (3 proteins)
    elaborated common fold
  6. 1601487Protein automated matches [228323] (2 species)
    not a true protein
  7. 1601488Species Salmonella typhimurium [TaxId:99287] [228324] (2 PDB entries)
  8. 1601489Domain d4ilfa2: 4ilf A:61-213 [228329]
    Other proteins in same PDB: d4ilfa1, d4ilfb1
    automated match to d1eeja1

Details for d4ilfa2

PDB Entry: 4ilf (more details), 2 Å

PDB Description: crystal structure of dsbc r125a from salmonella enterica serovar typhimurium
PDB Compounds: (A:) thiol:disulfide interchange protein dsbc

SCOPe Domain Sequences for d4ilfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ilfa2 c.47.1.9 (A:61-213) automated matches {Salmonella typhimurium [TaxId: 99287]}
nvtnkllmsqlnalekemivykapdekhvitvftditcgychklheemkdynalgitvry
lafpaqglesqaeqdmksiwcakdknkafddamagkgvkpascdvniadhyalgvqlgvs
gtpaivlsngyvvpgyqgpkemkafldehqkqt

SCOPe Domain Coordinates for d4ilfa2:

Click to download the PDB-style file with coordinates for d4ilfa2.
(The format of our PDB-style files is described here.)

Timeline for d4ilfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ilfa1