Lineage for d4i5qb1 (4i5q B:1-60)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1896155Superfamily d.17.3: DsbC/DsbG N-terminal domain-like [54423] (2 families) (S)
  5. 1896188Family d.17.3.0: automated matches [228319] (1 protein)
    not a true family
  6. 1896189Protein automated matches [228320] (2 species)
    not a true protein
  7. 1896190Species Salmonella typhimurium [TaxId:99287] [228321] (2 PDB entries)
  8. 1896194Domain d4i5qb1: 4i5q B:1-60 [228326]
    Other proteins in same PDB: d4i5qa2, d4i5qb2
    automated match to d1eeja2
    complexed with mg

Details for d4i5qb1

PDB Entry: 4i5q (more details), 1.96 Å

PDB Description: crystal structure and catalytic mechanism for peroplasmic disulfide- bond isomerase dsbc from salmonella enterica serovar typhimurium
PDB Compounds: (B:) thiol:disulfide interchange protein dsbc

SCOPe Domain Sequences for d4i5qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i5qb1 d.17.3.0 (B:1-60) automated matches {Salmonella typhimurium [TaxId: 99287]}
mdaairqslaklgvqsteiqaspvagmktvlthsgvlyvtddgkhiiqgpmydvsgahpv

SCOPe Domain Coordinates for d4i5qb1:

Click to download the PDB-style file with coordinates for d4i5qb1.
(The format of our PDB-style files is described here.)

Timeline for d4i5qb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i5qb2