Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.3: DsbC/DsbG N-terminal domain-like [54423] (2 families) |
Family d.17.3.0: automated matches [228319] (1 protein) not a true family |
Protein automated matches [228320] (2 species) not a true protein |
Species Salmonella typhimurium [TaxId:99287] [228321] (2 PDB entries) |
Domain d4i5qa1: 4i5q A:-5-60 [228322] Other proteins in same PDB: d4i5qa2, d4i5qb2 automated match to d1eeja2 complexed with mg |
PDB Entry: 4i5q (more details), 1.96 Å
SCOPe Domain Sequences for d4i5qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i5qa1 d.17.3.0 (A:-5-60) automated matches {Salmonella typhimurium [TaxId: 99287]} amdpefmdaairqslaklgvqsteiqaspvagmktvlthsgvlyvtddgkhiiqgpmydv sgahpv
Timeline for d4i5qa1: