SCOPe 2.05: Domain d4hpha2: 4hph A:521-600

Lineage for d4hpha2 (4hph A:521-600)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (30 species)
   not a true protein

7. Species Erwinia rhapontici [TaxId:55212] [228313] (5 PDB entries)

8. Domain d4hpha2: 4hph A:521-600 [228318]
   Other proteins in same PDB: d4hpha1
   automated match to d3gbda2
   complexed with ca, gol, suc; mutant

Details for d4hpha2

PDB Entry: 4hph, 1.7 Å

PDB Description: the crystal structure of isomaltulose synthase mutant e295q from erwinia rhapontici nx5 in complex with its natural substrate sucrose

PDB Compounds: (A:) Sucrose isomerase

SCOPe Domain Sequences for d4hpha2:

Sequence; same for both SEQRES and ATOM records:

>d4hpha2 b.71.1.0 (A:521-600) automated matches {Erwinia rhapontici [TaxId: 55212]}
gsyidldpdnnsvyaytrtlgaekylvvinfkeevmhytlpgdlsinkvitennshtivn
kndrqlrlepwqsgiyklnp

Timeline for d4hpha2:

• d4hpha2 first appeared in SCOPe 2.03
  
• d4hpha2 appears in SCOPe 2.04
  
• d4hpha2 appears in SCOPe 2.06
  
• d4hpha2 appears in the current release, SCOPe 2.08