Lineage for d4hoza2 (4hoz A:521-600)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804045Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1804046Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1804620Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 1804621Protein automated matches [226835] (30 species)
    not a true protein
  7. 1804643Species Erwinia rhapontici [TaxId:55212] [228313] (5 PDB entries)
  8. 1804646Domain d4hoza2: 4hoz A:521-600 [228316]
    Other proteins in same PDB: d4hoza1
    automated match to d3gbda2
    complexed with ca, glc, gol; mutant

Details for d4hoza2

PDB Entry: 4hoz (more details), 2 Å

PDB Description: the crystal structure of isomaltulose synthase mutant d241a from erwinia rhapontici nx5 in complex with d-glucose
PDB Compounds: (A:) Sucrose isomerase

SCOPe Domain Sequences for d4hoza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hoza2 b.71.1.0 (A:521-600) automated matches {Erwinia rhapontici [TaxId: 55212]}
gsyidldpdnnsvyaytrtlgaekylvvinfkeevmhytlpgdlsinkvitennshtivn
kndrqlrlepwqsgiyklnp

SCOPe Domain Coordinates for d4hoza2:

Click to download the PDB-style file with coordinates for d4hoza2.
(The format of our PDB-style files is described here.)

Timeline for d4hoza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hoza1