Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (30 species) not a true protein |
Species Erwinia rhapontici [TaxId:55212] [228313] (5 PDB entries) |
Domain d4hoza2: 4hoz A:521-600 [228316] Other proteins in same PDB: d4hoza1 automated match to d3gbda2 complexed with ca, glc, gol; mutant |
PDB Entry: 4hoz (more details), 2 Å
SCOPe Domain Sequences for d4hoza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hoza2 b.71.1.0 (A:521-600) automated matches {Erwinia rhapontici [TaxId: 55212]} gsyidldpdnnsvyaytrtlgaekylvvinfkeevmhytlpgdlsinkvitennshtivn kndrqlrlepwqsgiyklnp
Timeline for d4hoza2: