SCOPe 2.08: Domain d4hila_: 4hil A:

Lineage for d4hila_ (4hil A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
   beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)

4. Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families)

5. Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)

6. Protein automated matches [190702] (5 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187846] (5 PDB entries)

8. Domain d4hila_: 4hil A: [228301]
   automated match to d3musa_
   complexed with hem, na

Details for d4hila_

PDB Entry: 4hil, 1.25 Å

PDB Description: 1.25a resolution structure of rat type b cytochrome b5

PDB Compounds: (A:) Cytochrome b5 type B

SCOPe Domain Sequences for d4hila_:

Sequence; same for both SEQRES and ATOM records:

>d4hila_ d.120.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pavtyyrleevakrntaeetwmvihgrvyditrflsehpggeevlleqagadatesfedv
ghspdaremlkqyyigdvhpndlkp

Timeline for d4hila_:

• d4hila_ first appeared in SCOPe 2.03
  
• d4hila_ appears in SCOPe 2.07