SCOP 1.75: Domain d1eocb_: 1eoc B:

Lineage for d1eocb_ (1eoc B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)

7. Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49491] (16 PDB entries)

8. Domain d1eocb_: 1eoc B: [22830]
   Other proteins in same PDB: d1eoca_
   complexed with 4nc, fe

Details for d1eocb_

PDB Entry: 1eoc, 2.25 Å

PDB Description: crystal structure of acinetobacter sp. adp1 protocatechuate 3,4- dioxygenase in complex with 4-nitrocatechol

PDB Compounds: (B:) protocatechuate 3,4-dioxygenase beta chain

SCOP Domain Sequences for d1eocb_:

Sequence; same for both SEQRES and ATOM records:

>d1eocb_ b.3.6.1 (B:) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]}
iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg
dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt

Timeline for d1eocb_:

• d1eocb_ first appeared (with stable ids) in SCOP 1.55
  
• d1eocb_ appears in SCOP 1.73
  
• d1eocb_ appears in SCOPe 2.01
  
• d1eocb_ appears in the current release, SCOPe 2.08