Class b: All beta proteins [48724] (165 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) |
Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins) sandwich; 9 strands in 2 sheets |
Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species) |
Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49491] (12 PDB entries) |
Domain d1eocb_: 1eoc B: [22830] Other proteins in same PDB: d1eoca_ complexed with 4nc, fe |
PDB Entry: 1eoc (more details), 2.25 Å
SCOP Domain Sequences for d1eocb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eocb_ b.3.6.1 (B:) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]} iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt
Timeline for d1eocb_: