Lineage for d1eocb_ (1eoc B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10499Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 10679Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 10680Family b.3.6.1: Aromatic compound dioxygenase [49483] (3 proteins)
  6. 10789Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 10790Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49491] (5 PDB entries)
  8. 10795Domain d1eocb_: 1eoc B: [22830]
    Other proteins in same PDB: d1eoca_

Details for d1eocb_

PDB Entry: 1eoc (more details), 2.25 Å

PDB Description: crystal structure of acinetobacter sp. adp1 protocatechuate 3,4- dioxygenase in complex with 4-nitrocatechol

SCOP Domain Sequences for d1eocb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eocb_ b.3.6.1 (B:) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1}
iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg
dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt

SCOP Domain Coordinates for d1eocb_:

Click to download the PDB-style file with coordinates for d1eocb_.
(The format of our PDB-style files is described here.)

Timeline for d1eocb_: