Lineage for d4e0fa1 (4e0f A:1-96)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2385975Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2386485Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2386687Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2386688Protein automated matches [226870] (20 species)
    not a true protein
  7. 2386696Species Brucella abortus [TaxId:235] [228298] (4 PDB entries)
  8. 2386715Domain d4e0fa1: 4e0f A:1-96 [228299]
    Other proteins in same PDB: d4e0fb3
    automated match to d1kzla1
    complexed with rbf

Details for d4e0fa1

PDB Entry: 4e0f (more details), 2.85 Å

PDB Description: Crystallographic structure of trimeric Riboflavin Synthase from Brucella abortus in complex with riboflavin
PDB Compounds: (A:) Riboflavin synthase subunit alpha

SCOPe Domain Sequences for d4e0fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e0fa1 b.43.4.0 (A:1-96) automated matches {Brucella abortus [TaxId: 235]}
mftgiitdigkvdrvkplnegvllrietaydpetielgasiacsgvcltvvalpekgsna
rwfeveaweealrlttisswqsgrkinlerslklgd

SCOPe Domain Coordinates for d4e0fa1:

Click to download the PDB-style file with coordinates for d4e0fa1.
(The format of our PDB-style files is described here.)

Timeline for d4e0fa1: