Lineage for d4c9za1 (4c9z A:91-282)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773292Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773293Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 2773395Family b.8.1.2: SIAH, seven in absentia homolog [69198] (2 proteins)
    automatically mapped to Pfam PF03145
  6. 2773404Protein automated matches [190456] (1 species)
    not a true protein
  7. 2773405Species Human (Homo sapiens) [TaxId:9606] [187371] (5 PDB entries)
  8. 2773410Domain d4c9za1: 4c9z A:91-282 [228297]
    Other proteins in same PDB: d4c9za2
    automated match to d1k2fa_
    complexed with cl, gol, so4, trs, zn

Details for d4c9za1

PDB Entry: 4c9z (more details), 1.95 Å

PDB Description: Crystal structure of Siah1 at 1.95 A resolution
PDB Compounds: (A:) E3 ubiquitin-protein ligase SIAH1

SCOPe Domain Sequences for d4c9za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c9za1 b.8.1.2 (A:91-282) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ansvlfpckyassgceitlphtekadheelcefrpyscpcpgasckwqgsldavmphlmh
qhksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekydghqqffaivq
ligtrkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaen
gnlginvtismc

SCOPe Domain Coordinates for d4c9za1:

Click to download the PDB-style file with coordinates for d4c9za1.
(The format of our PDB-style files is described here.)

Timeline for d4c9za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4c9za2
View in 3D
Domains from other chains:
(mouse over for more information)
d4c9zb_