SCOPe 2.08: Domain d4c9za1: 4c9z A:91-282

Lineage for d4c9za1 (4c9z A:91-282)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (3 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.2: SIAH, seven in absentia homolog [69198] (2 proteins)
   automatically mapped to Pfam PF03145

6. Protein automated matches [190456] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187371] (5 PDB entries)

8. Domain d4c9za1: 4c9z A:91-282 [228297]
   Other proteins in same PDB: d4c9za2
   automated match to d1k2fa_
   complexed with cl, gol, so4, trs, zn

Details for d4c9za1

PDB Entry: 4c9z, 1.95 Å

PDB Description: Crystal structure of Siah1 at 1.95 A resolution

PDB Compounds: (A:) E3 ubiquitin-protein ligase SIAH1

SCOPe Domain Sequences for d4c9za1:

Sequence; same for both SEQRES and ATOM records:

>d4c9za1 b.8.1.2 (A:91-282) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ansvlfpckyassgceitlphtekadheelcefrpyscpcpgasckwqgsldavmphlmh
qhksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekydghqqffaivq
ligtrkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaen
gnlginvtismc

Timeline for d4c9za1:

• d4c9za1 first appeared in SCOPe 2.03, called d4c9za_
  
• d4c9za1 appears in SCOPe 2.07