Lineage for d1eobb_ (1eob B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106204Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 106403Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 106404Family b.3.6.1: Aromatic compound dioxygenase [49483] (3 proteins)
  6. 106513Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 106514Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49491] (5 PDB entries)
  8. 106517Domain d1eobb_: 1eob B: [22829]
    Other proteins in same PDB: d1eoba_

Details for d1eobb_

PDB Entry: 1eob (more details), 2.2 Å

PDB Description: crystal structure of acinetobacter sp. adp1 protocatechuate 3,4- dioxygenase in complex with 3,4-dihydroxybenzoate

SCOP Domain Sequences for d1eobb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eobb_ b.3.6.1 (B:) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1}
iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg
dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt

SCOP Domain Coordinates for d1eobb_:

Click to download the PDB-style file with coordinates for d1eobb_.
(The format of our PDB-style files is described here.)

Timeline for d1eobb_: