Lineage for d4bcta_ (4bct A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1306834Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 1306835Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 1306836Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. 1306898Protein automated matches [190195] (5 species)
    not a true protein
  7. 1306899Species Actinidia deliciosa [TaxId:3627] [228288] (1 PDB entry)
  8. 1306900Domain d4bcta_: 4bct A: [228289]
    automated match to d1z3qa_
    complexed with epe

Details for d4bcta_

PDB Entry: 4bct (more details), 0.98 Å

PDB Description: Crystal structure of kiwi-fruit allergen Act d 2
PDB Compounds: (A:) Thaumatin-like protein

SCOPe Domain Sequences for d4bcta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bcta_ b.25.1.1 (A:) automated matches {Actinidia deliciosa [TaxId: 3627]}
atfniinncpftvwaaavpgggkrldrgqnwiinpgagtkgarvwprtgcnfdgagrgkc
qtgdcngllqcqafgqppntlaeyalnqfnnldffdislvdgfnvamefsptsggctrgi
kctadingqcpnelrapggcnnpctvfktdqyccnsgncgltnfskffkdrcpdaysypk
ddqtstftcpagtnykvvfcp

SCOPe Domain Coordinates for d4bcta_:

Click to download the PDB-style file with coordinates for d4bcta_.
(The format of our PDB-style files is described here.)

Timeline for d4bcta_: