| Class b: All beta proteins [48724] (174 folds) |
| Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily) sandwich; 11 strands in 2 sheets |
Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) ![]() has two smaller insertion domains |
| Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins) automatically mapped to Pfam PF00314 |
| Protein automated matches [190195] (5 species) not a true protein |
| Species Actinidia deliciosa [TaxId:3627] [228288] (1 PDB entry) |
| Domain d4bcta_: 4bct A: [228289] automated match to d1z3qa_ complexed with epe |
PDB Entry: 4bct (more details), 0.98 Å
SCOPe Domain Sequences for d4bcta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bcta_ b.25.1.1 (A:) automated matches {Actinidia deliciosa [TaxId: 3627]}
atfniinncpftvwaaavpgggkrldrgqnwiinpgagtkgarvwprtgcnfdgagrgkc
qtgdcngllqcqafgqppntlaeyalnqfnnldffdislvdgfnvamefsptsggctrgi
kctadingqcpnelrapggcnnpctvfktdqyccnsgncgltnfskffkdrcpdaysypk
ddqtstftcpagtnykvvfcp
Timeline for d4bcta_: